General Information

  • ID:  hor006663
  • Uniprot ID:  Q27IM2
  • Protein name:  Parathyroid hormone
  • Gene name:  PTH
  • Organism:  Equus caballus (Horse)
  • Family:  Parathyroid hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031856 parathyroid hormone receptor binding; GO:0031857 type 1 parathyroid hormone receptor binding; GO:0048018 receptor ligand activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0006366 transcription by RNA polymerase II; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0009059 macromolecule biosynthetic process; GO:0009967 positive regulation of signal transduction; GO:0010468 regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0010960 magnesium ion homeostasis; GO:0030282 bone mineralization; GO:0030501 positive regulation of bone mineralization; GO:0045725 positive regulation of glycogen biosynthetic process; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046326 positive regulation of glucose import; GO:0048873 homeostasis of number of cells within a tissue; GO:0055062 phosphate ion homeostasis; GO:0055074 calcium ion homeostasis; GO:0060732 positive regulation of inositol phosphate biosynthetic process; GO:0071864 positive regulation of cell proliferation in bone marrow; GO:0071866 negative regulation of apoptotic process in bone marrow cell; GO:0090290 positive regulation of osteoclast proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ
  • Length:  84
  • Propeptide:  MMSAKNMVKVMIVMFAIFLLAKSDGKPVRKRSVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ
  • Signal peptide:  MMSAKNMVKVMIVMFAIFLLAKSDG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R, PTH2R
  • Target Unid:  F6Z5Y6, F7D3V7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q27IM2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006663_AF2.pdbhor006663_ESM.pdb

Physical Information

Mass: 1101948 Formula: C416H680N128O127S
Absent amino acids: CY Common amino acids: KLS
pI: 9.91 Basic residues: 19
Polar residues: 18 Hydrophobic residues: 27
Hydrophobicity: -76.19 Boman Index: -21024
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 89.29
Instability Index: 4398.21 Extinction Coefficient cystines: 5500
Absorbance 280nm: 66.27

Literature

  • PubMed ID:  NA
  • Title:  NA